Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53I3 Peptide - C-terminal region

TP53I3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PIG3

UniProt

B4DMQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TP53I3 Rabbit Polyclonal Antibody (orb585990) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAX00765

Preservative

Lyophilized powder

AA Sequence

SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (N-Cyclopropylsulfonamide) phenylboronic acid pinacol ester
429655-01 100 mg

4- (N-Cyclopropylsulfonamide) phenylboronic acid pinacol ester

Sign In for Pricing
View Details
4- (N-Cyclopropylsulfonamide) phenylboronic acid pinacol ester
429655-02 250 mg

4- (N-Cyclopropylsulfonamide) phenylboronic acid pinacol ester

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) ywhaba Polyclonal Antibody
MBS7195989 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) ywhaba Polyclonal Antibody

Sign In for Pricing
View Details
Buffer Solution pH 8.0 ±0.05 @ 25°c
B0051 00500 500 mL

Buffer Solution pH 8.0 ±0.05 @ 25°c

Sign In for Pricing
View Details
Human ARID1A / AT-rich interactive domain-containing protein 1A Recombinant Protein
R14644h 1 Each

Human ARID1A / AT-rich interactive domain-containing protein 1A Recombinant Protein

Sign In for Pricing
View Details
TBX20 Peptide - N-terminal region
MBS3226393-01 0.1 mg

TBX20 Peptide - N-terminal region

Sign In for Pricing
View Details