Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Peptide - C-terminal region

LILRA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85E, HM31, HM43, ILT6, LIR-4, LIR4, e3

UniProt

Q8N6C8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA3 Rabbit Polyclonal Antibody (orb586225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006856

Preservative

Lyophilized powder

AA Sequence

AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Echinacoside Ethanolate
TRC-E325620-50MG 50 mg

Echinacoside Ethanolate

Sign In for Pricing
View Details
SUV39H1 Human Gene Knockout Kit (CRISPR)
KN202428BN 1 Kit

SUV39H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (FABP5/3750), CF740 conjugate, 0.1mg/mL
BNC743750-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (FABP5/3750), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elymoclavin
TRC-E985790-5MG 5 mg

Elymoclavin

Sign In for Pricing
View Details
Crude Salvia horminum -SHA-
L-3400-10 10 mg

Crude Salvia horminum -SHA-

Sign In for Pricing
View Details
PAI1 (SERPINE1) (NM_001165413) Human Over-expression Lysate
LC431339 20 µg

PAI1 (SERPINE1) (NM_001165413) Human Over-expression Lysate

Sign In for Pricing
View Details