Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Peptide - C-terminal region

LILRA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85E, HM31, HM43, ILT6, LIR-4, LIR4, e3

UniProt

Q8N6C8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA3 Rabbit Polyclonal Antibody (orb586225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006856

Preservative

Lyophilized powder

AA Sequence

AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PML Protein (PML) (Sumoylation Site) Rabbit Polyclonal Antibody
AP12217PU-N 400 µL

PML Protein (PML) (Sumoylation Site) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPTLC3 Human Gene Knockout Kit (CRISPR)
KN424216 1 Kit

SPTLC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HAT1 (N-term) Rabbit Polyclonal Antibody
AP11103PU-N 400 µL

HAT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMT-153261
TRC-B473771-25MG 25 mg

BMT-153261

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624712 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Recombinant Mouse PIIINP protein (GST tag)
PDEM100260-01 20 µg

Recombinant Mouse PIIINP protein (GST tag)

Sign In for Pricing
View Details