Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH8 Peptide - middle region

RDH8 Peptide - middle region

Product Specifications

Product Name Alternative

PRRDH, SDR28C2

UniProt

Q9NYR8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RDH8 Rabbit Polyclonal Antibody (orb326534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056540

Preservative

Lyophilized powder

AA Sequence

FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin Rabbit pAb
A1300-01 20 µL

Leptin Rabbit pAb

Sign In for Pricing
View Details
Leptin Rabbit pAb
A1300-02 100 μL

Leptin Rabbit pAb

Sign In for Pricing
View Details
Leptin Rabbit pAb
A1300-03 500 μL

Leptin Rabbit pAb

Sign In for Pricing
View Details
Leptin Rabbit pAb
A1300-04 1000 μL

Leptin Rabbit pAb

Sign In for Pricing
View Details
SEPT13 sgRNA CRISPR Lentivector (Human) (Target 3)
K2120904 1.0 µg DNA

SEPT13 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SFXN5 Antibody (HRP)
orb34700-01 50 µg

SFXN5 Antibody (HRP)

Sign In for Pricing
View Details