Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH8 Peptide - middle region

RDH8 Peptide - middle region

Product Specifications

Product Name Alternative

PRRDH, SDR28C2

UniProt

Q9NYR8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RDH8 Rabbit Polyclonal Antibody (orb326534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056540

Preservative

Lyophilized powder

AA Sequence

FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C-X-C chemokine receptor type 6, Cxcr6 ELISA KIT
ELI-27082m 96 Tests

Mouse C-X-C chemokine receptor type 6, Cxcr6 ELISA KIT

Sign In for Pricing
View Details
C10orf115 CRISPR All-in-one AAV vector set (with saCas9)(Human)
13618151 3x 1.0 µg DNA

C10orf115 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
ZBED4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-13554R-BF405 100 µL

ZBED4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant Escherichia phage MS2 Capsid protein
CSB-EP365998ECZd7-01 20 µg

Recombinant Escherichia phage MS2 Capsid protein

Sign In for Pricing
View Details
Recombinant Escherichia phage MS2 Capsid protein
CSB-EP365998ECZd7-02 100 µg

Recombinant Escherichia phage MS2 Capsid protein

Sign In for Pricing
View Details
Recombinant Escherichia phage MS2 Capsid protein
CSB-EP365998ECZd7-03 1 mg

Recombinant Escherichia phage MS2 Capsid protein

Sign In for Pricing
View Details