Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITSN2 Peptide - C-terminal region

ITSN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1256, PRO2015, SH3D1B, SH3P18, SWA, SWAP

UniProt

E7EUQ1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITSN2 Rabbit Polyclonal Antibody (orb326543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671494

Preservative

Lyophilized powder

AA Sequence

TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROS1 siRNA (Mouse)
CRM3245-01 15 nmol

PROS1 siRNA (Mouse)

Sign In for Pricing
View Details
PROS1 siRNA (Mouse)
CRM3245-02 30 nmol

PROS1 siRNA (Mouse)

Sign In for Pricing
View Details
TSPAN33 Antibody, FITC conjugated
A59346-50UG 50 µg

TSPAN33 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal CD200R1 Antibody (118) [Janelia Fluor 646]
NBP2-89845JF646 0.1 mL

Rabbit Monoclonal CD200R1 Antibody (118) [Janelia Fluor 646]

Sign In for Pricing
View Details
Tpp1 sgRNA CRISPR Lentivector set (Mouse)
K3405201 3x 1.0 µg

Tpp1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Nxf7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV638597 1.0 µg DNA

Nxf7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details