Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITSN2 Peptide - C-terminal region

ITSN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1256, PRO2015, SH3D1B, SH3P18, SWA, SWAP

UniProt

E7EUQ1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITSN2 Rabbit Polyclonal Antibody (orb326543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671494

Preservative

Lyophilized powder

AA Sequence

TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit
MBS7213751-01 48 Well

Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit

Sign In for Pricing
View Details
Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit
MBS7213751-02 96 Well

Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit

Sign In for Pricing
View Details
Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit
MBS7213751-03 5x 96 Well

Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit

Sign In for Pricing
View Details
Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit
MBS7213751-04 10x 96 Well

Monkey PDZ and LIM domain protein 3 (PDLIM3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Haptoglobin Antibody (HP/3838) [Biotin]
NBP3-26953B 0.1 mL

Mouse Monoclonal Haptoglobin Antibody (HP/3838) [Biotin]

Sign In for Pricing
View Details
Rabbit anti-Caldesmon Antibody, Affinity Purified
A304-164A- T 10 µg

Rabbit anti-Caldesmon Antibody, Affinity Purified

Sign In for Pricing
View Details