NIPSNAP1 Peptide - C-terminal region
NIPSNAP1 Peptide - C-terminal region
Product Specifications
UniProt
Q9BPW8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NIPSNAP1 Rabbit Polyclonal Antibody (orb586264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003625
Preservative
Lyophilized powder
AA Sequence
LRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWA
More Discoveries
Explore Other Products
Browse additional items from our catalog
317644 1 Roll (1 Roll x 1 Pack)
ISO20560PM-300X30M-ZUUR-RL Pipe Markers for Gases
Sign In for Pricing
View Details MBS7163886 Inquire
Rabbit anti-Escherichia coli O157:H7 EUTB Polyclonal Antibody
Sign In for Pricing
View Details CST 32248S 100 µL
Phospho-β-Dystroglycan (Tyr892) (E6T9O) Rabbit Monoclonal Antibody
Sign In for Pricing
View Details 
F9400-04M-ML750 100 µL
FXYD Domain-containing Ion Transport Regulator 1, phosphorylated (Ser88) (Phospholemman, PLM, Fxyd1, Plm) (MaxLight 750) discontinued
Sign In for Pricing
View Details A08610-2-Fluoro594 100 µg/Vial
Anti-MSY2/YBOX2/YBX2 Antibody Picoband® Fluoro594 Conjugated
Sign In for Pricing
View Details