Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPSNAP1 Peptide - C-terminal region

NIPSNAP1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BPW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIPSNAP1 Rabbit Polyclonal Antibody (orb586264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003625

Preservative

Lyophilized powder

AA Sequence

LRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWA

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLYCERINE100X33RL-T2-P2 Pipe Markers for Gases
N004279 505 Roll (505 Marker (s) x 1 Roll)

GLYCERINE100X33RL-T2-P2 Pipe Markers for Gases

Sign In for Pricing
View Details
Integrin β5 (F-5) HRP
sc-398214 HRP 200 µg/mL

Integrin β5 (F-5) HRP

Sign In for Pricing
View Details
AS1708727
C18334-1g 1 g

AS1708727

Sign In for Pricing
View Details
Gm10334 (NM_001103153) Mouse Tagged ORF Clone Lentiviral Particle
MR214738L3V 200 µL

Gm10334 (NM_001103153) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS522561 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Muscle actin Mouse Monoclonal Antibody (4G10)
ABM40298-01 30 µL

Muscle actin Mouse Monoclonal Antibody (4G10)

Sign In for Pricing
View Details