Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHAX Peptide - C-terminal region

PHAX Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13193, RNUXA

UniProt

Q9H814

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHAX Rabbit Polyclonal Antibody (orb586267) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115553

Preservative

Lyophilized powder

AA Sequence

DIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Deoxy-2,2-difluoro-D-erythro-ribofuranose-3,5-dibenzoate
TRC-D232785-500MG 500 mg

2-Deoxy-2,2-difluoro-D-erythro-ribofuranose-3,5-dibenzoate

Sign In for Pricing
View Details
ELP4 (NM_019040) Human Recombinant Protein
TP319128 20 µg

ELP4 (NM_019040) Human Recombinant Protein

Sign In for Pricing
View Details
GSK3 beta (GSK3B) pSer9 Rabbit Polyclonal Antibody
AP02304PU-N 100 µL

GSK3 beta (GSK3B) pSer9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beta-Nicotinamide Adenine Dinucleotide-d4 (major)
TRC-N407783-5MG 5 mg

Beta-Nicotinamide Adenine Dinucleotide-d4 (major)

Sign In for Pricing
View Details
Human ACTH (POMC) activation kit by CRISPRa
GA103666 1 Kit

Human ACTH (POMC) activation kit by CRISPRa

Sign In for Pricing
View Details
MyGel InstaView™ Complete Electrophoresis System with Blue LED Illuminator, 230V input
E1201-E 1 Each

MyGel InstaView™ Complete Electrophoresis System with Blue LED Illuminator, 230V input

Sign In for Pricing
View Details