RPL27A Peptide - C-terminal region
RPL27A Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ43464, MGC10850, MGC17878, MGC87238, L27A
UniProt
P46776
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPL27A Rabbit Polyclonal Antibody (orb586270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000981
Preservative
Lyophilized powder
AA Sequence
GAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-9005-20 1 mL
Colloidal Gold Conjugated Morniga G Lectin (black mulberry) -MNA-G-, 20nm
Sign In for Pricing
View Details ![SCHIP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]](https://cdn.genprice.uk/products/937/6868c34f994c49e6dc3f459e/imageurl/ta504468am.webp)
TA504468AM 100 µL
SCHIP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]
Sign In for Pricing
View Details 
TP316073 20 µg
Junctional Adhesion MolecuLe C (JAM3) (NM_032801) Human Recombinant Protein
Sign In for Pricing
View Details 
