Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL27A Peptide - C-terminal region

RPL27A Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ43464, MGC10850, MGC17878, MGC87238, L27A

UniProt

P46776

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL27A Rabbit Polyclonal Antibody (orb586270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000981

Preservative

Lyophilized powder

AA Sequence

GAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGRF1 (NM_002891) Human Recombinant Protein
TP319147M 100 µg

RASGRF1 (NM_002891) Human Recombinant Protein

Sign In for Pricing
View Details
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF568 conjugate, 0.1mg/mL
BNC683635-100 1x 100 µL

Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIRT2 Recombinant Chimeric Antibody Antibody
HA610335 100 µL

SIRT2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
STAT2 Rabbit Polyclonal Antibody
TA392619 100 µL

STAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Contactin 3/CNTN3 Protein (708 Asp/Asn, Fc Tag)
PKSH031803 100 µg

Recombinant Human Contactin 3/CNTN3 Protein (708 Asp/Asn, Fc Tag)

Sign In for Pricing
View Details
MEK1/2 (Ab-221) Antibody
8B7147-AAT 50 µg

MEK1/2 (Ab-221) Antibody

Sign In for Pricing
View Details