Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTP1 Peptide - N-terminal region

RTP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC35450

UniProt

P59025

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTP1 Rabbit Polyclonal Antibody (orb586273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_714919

Preservative

Lyophilized powder

AA Sequence

RWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smoothelin Rabbit pAb, Pacific Blue conjugated
orb2887731 100 µL

Smoothelin Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
IGLC6 sgRNA CRISPR Lentivector (Human) (Target 1)
K1061502 1.0 µg DNA

IGLC6 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Goat anti-LYVE1 Antibody
dAP-3229 50 µg

Goat anti-LYVE1 Antibody

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Protein-export protein secB (secB)
MBS1057397-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup C Protein-export protein secB (secB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Protein-export protein secB (secB)
MBS1057397-02 0.1 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup C Protein-export protein secB (secB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Protein-export protein secB (secB)
MBS1057397-03 0.02 mg (Yeast)

Recombinant Neisseria meningitidis serogroup C Protein-export protein secB (secB)

Sign In for Pricing
View Details