Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCTR Peptide - N-terminal region

SCTR Peptide - N-terminal region

Product Specifications

Product Name Alternative

SR

UniProt

P47872

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCTR Rabbit Polyclonal Antibody (orb586274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002971

Preservative

Lyophilized powder

AA Sequence

NLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm5922 Mouse siRNA Oligo Duplex (Locus ID 546166)
SR402635 1 Kit

Gm5922 Mouse siRNA Oligo Duplex (Locus ID 546166)

Sign In for Pricing
View Details
Acremolactone A
orb3024140-01 50 mg

Acremolactone A

Sign In for Pricing
View Details
Acremolactone A
orb3024140-02 10 mg

Acremolactone A

Sign In for Pricing
View Details
NIPP1 (PPP1R8) (NM_014110) Human Mass Spec Standard
PH318843 10 µg

NIPP1 (PPP1R8) (NM_014110) Human Mass Spec Standard

Sign In for Pricing
View Details
APCDD1 Rabbit Polyclonal Antibody (BF750)
orb2504453 100 µL

APCDD1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Ces2g ORF Vector (Mouse) (pORF)
15950014 1.0 µg DNA

Ces2g ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details