Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L1 Peptide - N-terminal region

SEC14L1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686C06176, PRELID4A, SEC14L

UniProt

Q92503

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC14L1 Rabbit Polyclonal Antibody (orb586275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137473

Preservative

Lyophilized powder

AA Sequence

GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HoxA11 (B-11) Alexa Fluor® 594
sc-393440 AF594 200 µg/mL

HoxA11 (B-11) Alexa Fluor® 594

Sign In for Pricing
View Details
Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His)
32-7370-50 50 µg

Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His)

Sign In for Pricing
View Details
Recombinant Human FGF-7/HBGF-7/KGF Protein
RP01717-01 10 μg

Recombinant Human FGF-7/HBGF-7/KGF Protein

Sign In for Pricing
View Details
Recombinant Human FGF-7/HBGF-7/KGF Protein
RP01717-02 20 μg

Recombinant Human FGF-7/HBGF-7/KGF Protein

Sign In for Pricing
View Details
Recombinant Human FGF-7/HBGF-7/KGF Protein
RP01717-03 50 μg

Recombinant Human FGF-7/HBGF-7/KGF Protein

Sign In for Pricing
View Details
Recombinant Human FGF-7/HBGF-7/KGF Protein
RP01717-04 100 μg

Recombinant Human FGF-7/HBGF-7/KGF Protein

Sign In for Pricing
View Details