Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L1 Peptide - N-terminal region

SEC14L1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686C06176, PRELID4A, SEC14L

UniProt

Q92503

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC14L1 Rabbit Polyclonal Antibody (orb586275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137473

Preservative

Lyophilized powder

AA Sequence

GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Audiometer
LE-AM101 1 Unit

Audiometer

Sign In for Pricing
View Details
TRAV12-3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2444408 1.0 µg DNA

TRAV12-3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein
abx659477-01 10 µg

Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein

Sign In for Pricing
View Details
Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein
abx659477-02 50 µg

Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein

Sign In for Pricing
View Details
Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein
abx659477-03 100 µg

Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein

Sign In for Pricing
View Details
Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein
abx659477-04 200 µg

Human Dedicator Of Cytokinesis Protein 7 (DOCK7) Protein

Sign In for Pricing
View Details