Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK19 Peptide - middle region

STK19 Peptide - middle region

Product Specifications

Product Name Alternative

D6S60, D6S60E, G11, HLA-RP1, MGC117388, RP1

UniProt

P49842

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK19 Rabbit Polyclonal Antibody (orb586276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115830

Preservative

Lyophilized powder

AA Sequence

PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Secreted Frizzled Related Protein 4 (SFRP4) Rat ELISA Kit
G9234 96 Tests

Secreted Frizzled Related Protein 4 (SFRP4) Rat ELISA Kit

Sign In for Pricing
View Details
BCOR Antibody
34170-01 50 µL

BCOR Antibody

Sign In for Pricing
View Details
BCOR Antibody
34170-02 100 µL

BCOR Antibody

Sign In for Pricing
View Details
REXO1L3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1810508 1.0 µg DNA

REXO1L3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DHODH Peptide
MBS3231088-01 0.1 mg

DHODH Peptide

Sign In for Pricing
View Details
DHODH Peptide
MBS3231088-02 5x 0.1 mg

DHODH Peptide

Sign In for Pricing
View Details