Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK19 Peptide - middle region

STK19 Peptide - middle region

Product Specifications

Product Name Alternative

D6S60, D6S60E, G11, HLA-RP1, MGC117388, RP1

UniProt

P49842

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK19 Rabbit Polyclonal Antibody (orb586276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115830

Preservative

Lyophilized powder

AA Sequence

PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OSM R beta Alexa Fluor 405 Antibody (Clone 469221)
FAB4389V-100UG 100 µg

Human OSM R beta Alexa Fluor 405 Antibody (Clone 469221)

Sign In for Pricing
View Details
Villin Rabbit Monoclonal Antibody
AMRe87099-01 1 Each

Villin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Villin Rabbit Monoclonal Antibody
AMRe87099-02 50 µL

Villin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Villin Rabbit Monoclonal Antibody
AMRe87099-03 100 µL

Villin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C5AR2 Monoclonal Antibody
BT-MCA3024-01 50 µL

C5AR2 Monoclonal Antibody

Sign In for Pricing
View Details
C5AR2 Monoclonal Antibody
BT-MCA3024-02 100 µL

C5AR2 Monoclonal Antibody

Sign In for Pricing
View Details