Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREH Peptide - middle region

TREH Peptide - middle region

Product Specifications

Product Name Alternative

MGC129621, TRE, TREA

UniProt

O43280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREH Rabbit Polyclonal Antibody (orb326545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009111

Preservative

Lyophilized powder

AA Sequence

NYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD338/ABCG2 Mouse Monoclonal Antibody (FITC)
orb2973501-01 50 Tests

CD338/ABCG2 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CD338/ABCG2 Mouse Monoclonal Antibody (FITC)
orb2973501-02 100 Tests

CD338/ABCG2 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
Dfnb59 3'UTR Luciferase Stable Cell Line
TU203362 1.0 mL

Dfnb59 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-PLA2G10 Antibody Picoband® HRP Conjugated
A07633-HRP 100 µg/Vial

Anti-PLA2G10 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
PI 3 Kinase catalytic subunit gamma (PIK3CG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C6]
TA505226BM 100 µL

PI 3 Kinase catalytic subunit gamma (PIK3CG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C6]

Sign In for Pricing
View Details
Human CD279/PDCD1/PD1 Antibody , PE
E55A10679 50 Tests

Human CD279/PDCD1/PD1 Antibody , PE

Sign In for Pricing
View Details