Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREH Peptide - middle region

TREH Peptide - middle region

Product Specifications

Product Name Alternative

MGC129621, TRE, TREA

UniProt

O43280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREH Rabbit Polyclonal Antibody (orb326545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009111

Preservative

Lyophilized powder

AA Sequence

NYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Smegmatis rpmE Protein (aa 1-75)
VAng-Yyj4813-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Smegmatis rpmE Protein (aa 1-75)

Sign In for Pricing
View Details
CPA1 Antibody / Carboxypeptidase A1
V5226SAF-100UG 100 µg

CPA1 Antibody / Carboxypeptidase A1

Sign In for Pricing
View Details
Atf7 3'UTR GFP Stable Cell Line
TU251019 1.0 mL

Atf7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bovine Short Transient Receptor Potential Channel 6 (TRPC6) ELISA Kit
MBS9389179-01 48 Well

Bovine Short Transient Receptor Potential Channel 6 (TRPC6) ELISA Kit

Sign In for Pricing
View Details
Bovine Short Transient Receptor Potential Channel 6 (TRPC6) ELISA Kit
MBS9389179-02 96 Well

Bovine Short Transient Receptor Potential Channel 6 (TRPC6) ELISA Kit

Sign In for Pricing
View Details
Bovine Short Transient Receptor Potential Channel 6 (TRPC6) ELISA Kit
MBS9389179-03 5x 96 Well

Bovine Short Transient Receptor Potential Channel 6 (TRPC6) ELISA Kit

Sign In for Pricing
View Details