Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP8 Peptide - middle region

ARHGAP8 Peptide - middle region

Product Specifications

Product Name Alternative

BPGAP1, FLJ20185, PP610

UniProt

Q86XV6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP8 Rabbit Polyclonal Antibody (orb326549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851852

Preservative

Lyophilized powder

AA Sequence

PRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NDUFAF1 Antibody
RC-5376-01 50 μL

Recombinant NDUFAF1 Antibody

Sign In for Pricing
View Details
Recombinant NDUFAF1 Antibody
RC-5376-02 100 µL

Recombinant NDUFAF1 Antibody

Sign In for Pricing
View Details
Recombinant NDUFAF1 Antibody
RC-5376-03 1 mL

Recombinant NDUFAF1 Antibody

Sign In for Pricing
View Details
Replacement cap, standard blue (GL45), 10/pk.
B3000-CAP* 1 Each

Replacement cap, standard blue (GL45), 10/pk.

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details