ARHGAP8 Peptide - middle region
ARHGAP8 Peptide - middle region
Product Specifications
Product Name Alternative
BPGAP1, FLJ20185, PP610
UniProt
Q86XV6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGAP8 Rabbit Polyclonal Antibody (orb326549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_851852
Preservative
Lyophilized powder
AA Sequence
PRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040627-100 1x 100 µL
Cytokeratin 8 (TS1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![ASH2L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]](https://cdn.genprice.uk/products/937/68dd1b85061270361ea1fe2d/imageurl/ta810988bm.webp)
TA810988BM 100 µL
ASH2L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
Sign In for Pricing
View Details ![RPP20 (POP7) Mouse Monoclonal Antibody [Clone ID: 1F11]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd222/imageurl/am32014pu-n.webp)
AM32014PU-N 100 µg
RPP20 (POP7) Mouse Monoclonal Antibody [Clone ID: 1F11]
Sign In for Pricing
View Details 
