Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CH25H Peptide - C-terminal region

CH25H Peptide - C-terminal region

Product Specifications

Product Name Alternative

C25H

UniProt

O95992

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CH25H Rabbit Polyclonal Antibody (orb586279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003947

Preservative

Lyophilized powder

AA Sequence

VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAE14 Protein Lysate (Human) with C-Ha Tag
47980031 100 µg

TRNAE14 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Bovine Macrophage migration inhibitory factor (MIF) ELISA Kit
RK07183 96 Tests

Bovine Macrophage migration inhibitory factor (MIF) ELISA Kit

Sign In for Pricing
View Details
CSRNP1 CRISPR Knock Out 293T Cell Line (Human)
16963141 1x 10^6 Cells / 1.0 mL

CSRNP1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Axis Inhibition Protein (AXIN) Porcine ELISA Kit
B7593 96 Tests

Axis Inhibition Protein (AXIN) Porcine ELISA Kit

Sign In for Pricing
View Details
Alisertib (Standard)
HY-10971R-01 5 mg

Alisertib (Standard)

Sign In for Pricing
View Details
Alisertib (Standard)
HY-10971R-02 10 mg

Alisertib (Standard)

Sign In for Pricing
View Details