Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CH25H Peptide - C-terminal region

CH25H Peptide - C-terminal region

Product Specifications

Product Name Alternative

C25H

UniProt

O95992

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CH25H Rabbit Polyclonal Antibody (orb586279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003947

Preservative

Lyophilized powder

AA Sequence

VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOL9 Antibody (C-term) [APR06213G]
APR06213G-01 50 µL

NOL9 Antibody (C-term) [APR06213G]

Sign In for Pricing
View Details
NOL9 Antibody (C-term) [APR06213G]
APR06213G-02 100 µL

NOL9 Antibody (C-term) [APR06213G]

Sign In for Pricing
View Details
NOL9 Antibody (C-term) [APR06213G]
APR06213G-03 200 µL

NOL9 Antibody (C-term) [APR06213G]

Sign In for Pricing
View Details
NOL9 Antibody (C-term) [APR06213G]
APR06213G-04 400 µL

NOL9 Antibody (C-term) [APR06213G]

Sign In for Pricing
View Details
Recombinant Human IMMT Protein, N-His
AP94134 50 µg

Recombinant Human IMMT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2) -VLPs
orb2659054-01 20 µg

Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2) -VLPs

Sign In for Pricing
View Details