Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPP7 Peptide - middle region

DPP7 Peptide - middle region

Product Specifications

Product Name Alternative

DPP2, DPPII, QPP

UniProt

Q9UHL4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPP7 Rabbit Polyclonal Antibody (orb586281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037511

Preservative

Lyophilized powder

AA Sequence

FRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAFTVLAMMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrosialin CD68 Rabbit Polyclonal Antibody (FITC)
orb2575807 100 µg

Macrosialin CD68 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
PIC W025-Tri 200-AL-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)
830027 1 Card (1 Panel (s) x 1 Pack)

PIC W025-Tri 200-AL-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
Phospho-Arrestin-Beta-1 (S412) Polyclonal Antibody
JOT-PHS00642-01 20 µL

Phospho-Arrestin-Beta-1 (S412) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Arrestin-Beta-1 (S412) Polyclonal Antibody
JOT-PHS00642-02 50 μL

Phospho-Arrestin-Beta-1 (S412) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Arrestin-Beta-1 (S412) Polyclonal Antibody
JOT-PHS00642-03 100 µL

Phospho-Arrestin-Beta-1 (S412) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ssr2 shRNA (UAS) - Lentiviral mouse Ssr2 shRNA (UAS) (100)
GTR15174606 1 Vial

Lentiviral mouse Ssr2 shRNA (UAS) - Lentiviral mouse Ssr2 shRNA (UAS) (100)

Sign In for Pricing
View Details