Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLRB1 Peptide - N-terminal region

DYNLRB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BITH, BLP, DNCL2A, DNLC2A, ROBLD1

UniProt

Q9NP97

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNLRB1 Rabbit Polyclonal Antibody (orb586283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054902

Preservative

Lyophilized powder

AA Sequence

VNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute Carrier Family 12 Member 1 (SLC12A1) Antibody (APC)
abx447275 100 µg

Solute Carrier Family 12 Member 1 (SLC12A1) Antibody (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal DENR Antibody [Alexa Fluor 488]
NBP2-97745AF488 0.1 mL

Rabbit Polyclonal DENR Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Human CLMN Protein
E30P03766A 50 µg

Recombinant Human CLMN Protein

Sign In for Pricing
View Details
AIM1L, CT (AIM1L, CRYBG2, Absent in melanoma 1-like protein, Beta/gamma crystallin domain-containing protein 2) (MaxLight 550)
MBS6272428-01 0.1 mL

AIM1L, CT (AIM1L, CRYBG2, Absent in melanoma 1-like protein, Beta/gamma crystallin domain-containing protein 2) (MaxLight 550)

Sign In for Pricing
View Details
AIM1L, CT (AIM1L, CRYBG2, Absent in melanoma 1-like protein, Beta/gamma crystallin domain-containing protein 2) (MaxLight 550)
MBS6272428-02 5x 0.1 mL

AIM1L, CT (AIM1L, CRYBG2, Absent in melanoma 1-like protein, Beta/gamma crystallin domain-containing protein 2) (MaxLight 550)

Sign In for Pricing
View Details
STAT5A Mouse Monoclonal Antibody [Clone ID: OTI10H1]
TA502735S 30 µL

STAT5A Mouse Monoclonal Antibody [Clone ID: OTI10H1]

Sign In for Pricing
View Details