Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR34 Peptide - C-terminal region

GPR34 Peptide - C-terminal region

Product Specifications

UniProt

Q9UPC5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR34 Rabbit Polyclonal Antibody (orb586287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005291

Preservative

Lyophilized powder

AA Sequence

KGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD185/CXCR5 Antibody[J252D4]
E-AB-F1287C-01 20 Tests

FITC Anti-Human CD185/CXCR5 Antibody[J252D4]

Sign In for Pricing
View Details
FITC Anti-Human CD185/CXCR5 Antibody[J252D4]
E-AB-F1287C-02 100 Tests

FITC Anti-Human CD185/CXCR5 Antibody[J252D4]

Sign In for Pricing
View Details
FITC Anti-Human CD185/CXCR5 Antibody[J252D4]
E-AB-F1287C-03 2x 100 Tests

FITC Anti-Human CD185/CXCR5 Antibody[J252D4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS803140 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
BMP 7 Human
OM296904-01 10 µg

BMP 7 Human

Sign In for Pricing
View Details
BMP 7 Human
OM296904-02 2 µg

BMP 7 Human

Sign In for Pricing
View Details