Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR34 Peptide - C-terminal region

GPR34 Peptide - C-terminal region

Product Specifications

UniProt

Q9UPC5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR34 Rabbit Polyclonal Antibody (orb586288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005291

Preservative

Lyophilized powder

AA Sequence

SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNB1 antibody
70R-17525 50 ul

GNB1 antibody

Sign In for Pricing
View Details
MAN2B1 Protein Vector (Human) (pPM-C-HA)
27988021 500 ng

MAN2B1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ARRDC4 Antibody
E51A02779 100 µL

ARRDC4 Antibody

Sign In for Pricing
View Details
LHX5 (LIM Homeobox 5, MGC129689) (HRP)
MBS6180891-01 0.1 mL

LHX5 (LIM Homeobox 5, MGC129689) (HRP)

Sign In for Pricing
View Details
LHX5 (LIM Homeobox 5, MGC129689) (HRP)
MBS6180891-02 5x 0.1 mL

LHX5 (LIM Homeobox 5, MGC129689) (HRP)

Sign In for Pricing
View Details
MEF2A (Phospho-Ser408) Antibody
E11-0019A 100 µg -100 µL

MEF2A (Phospho-Ser408) Antibody

Sign In for Pricing
View Details