Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxo1 Peptide - N-terminal region

Foxo1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fkhr, Foxo1a

UniProt

G3V7R4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001178775

Preservative

Lyophilized powder

AA Sequence

MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGSTAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (FITC)
MBS6337592-01 0.2 mL

PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (FITC)

Sign In for Pricing
View Details
PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (FITC)
MBS6337592-02 5x 0.2 mL

PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (FITC)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cytochrome P450 86B1 (CYP86B1)
orb2923514-01 20 µg

Recombinant Arabidopsis thaliana Cytochrome P450 86B1 (CYP86B1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cytochrome P450 86B1 (CYP86B1)
orb2923514-02 100 µg

Recombinant Arabidopsis thaliana Cytochrome P450 86B1 (CYP86B1)

Sign In for Pricing
View Details
ANKRD5 CRISPR/Cas9 KO Plasmid (h)
sc-408943 20 µg

ANKRD5 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Foxh1 (Center) (DANRE) Rabbit pAb
E2617452 100 µL

Foxh1 (Center) (DANRE) Rabbit pAb

Sign In for Pricing
View Details