Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxo1 Peptide - N-terminal region

Foxo1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fkhr, Foxo1a

UniProt

G3V7R4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001178775

Preservative

Lyophilized powder

AA Sequence

MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGSTAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Solute Carrier Family 39, Member 4 (SLC39A4)
RPU55894-01 50 µg

Recombinant Human Solute Carrier Family 39, Member 4 (SLC39A4)

Sign In for Pricing
View Details
Recombinant Human Solute Carrier Family 39, Member 4 (SLC39A4)
RPU55894-02 100 µg

Recombinant Human Solute Carrier Family 39, Member 4 (SLC39A4)

Sign In for Pricing
View Details
Recombinant Human Solute Carrier Family 39, Member 4 (SLC39A4)
RPU55894-03 1 mg

Recombinant Human Solute Carrier Family 39, Member 4 (SLC39A4)

Sign In for Pricing
View Details
Recombinant Human GMF-beta Protein
E40KMP1046 20 µg

Recombinant Human GMF-beta Protein

Sign In for Pricing
View Details
Acetonitrile for ULC-MS
LC-11002.2 2.5 L

Acetonitrile for ULC-MS

Sign In for Pricing
View Details
Recombinant Human CD200 Receptor 1/CD200R1 (C-6His)
orb1649369-01 10 µg

Recombinant Human CD200 Receptor 1/CD200R1 (C-6His)

Sign In for Pricing
View Details