Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1I1 Peptide - C-terminal region

OR1I1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR19-20, OR1I1P, OR1I1Q

UniProt

O60431

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1I1 Rabbit Polyclonal Antibody (orb584418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004713

Preservative

Lyophilized powder

AA Sequence

GKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit B1, partial
MBS7065229 Inquire

Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit B1, partial

Sign In for Pricing
View Details
YAP1 Rabbit Polyclonal Antibody (RBITC)
orb1047382 100 µL

YAP1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
TTL, CT (TTL, Tubulin-tyrosine ligase) (FITC)
MBS6360027-01 0.2 mL

TTL, CT (TTL, Tubulin-tyrosine ligase) (FITC)

Sign In for Pricing
View Details
TTL, CT (TTL, Tubulin-tyrosine ligase) (FITC)
MBS6360027-02 5x 0.2 mL

TTL, CT (TTL, Tubulin-tyrosine ligase) (FITC)

Sign In for Pricing
View Details
Recombinant Xenopus laevis DNA-binding protein inhibitor ID-4 (id4)
MBS1397373-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis DNA-binding protein inhibitor ID-4 (id4)

Sign In for Pricing
View Details
Recombinant Xenopus laevis DNA-binding protein inhibitor ID-4 (id4)
MBS1397373-02 0.1 mg (E-Coli)

Recombinant Xenopus laevis DNA-binding protein inhibitor ID-4 (id4)

Sign In for Pricing
View Details