OR1I1 Peptide - C-terminal region
OR1I1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR19-20, OR1I1P, OR1I1Q
UniProt
O60431
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR1I1 Rabbit Polyclonal Antibody (orb584418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004713
Preservative
Lyophilized powder
AA Sequence
GKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6218494-01 0.1 mL
PCBP2 (poly(rC) Binding Protein 2, HNRPE2, MGC110998, hnRNP-E2) (MaxLight 550)
Sign In for Pricing
View Details MBS6218494-02 5x 0.1 mL
PCBP2 (poly(rC) Binding Protein 2, HNRPE2, MGC110998, hnRNP-E2) (MaxLight 550)
Sign In for Pricing
View Details EK7675 48 Tests
Human POTE ankyrin domain family member H (ACTBL1) ELISA Kit
Sign In for Pricing
View Details