Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THTPA Peptide - N-terminal region

THTPA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC2652, THTP, THTPASE

UniProt

Q9BU02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THTPA Rabbit Polyclonal Antibody (orb585470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077304

Preservative

Lyophilized powder

AA Sequence

KFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-1RL2
Pr23140-01 10 µg

Recombinant Mouse IL-1RL2

Sign In for Pricing
View Details
Recombinant Mouse IL-1RL2
Pr23140-02 50 µg

Recombinant Mouse IL-1RL2

Sign In for Pricing
View Details
Recombinant Mouse IL-1RL2
Pr23140-03 500 µg

Recombinant Mouse IL-1RL2

Sign In for Pricing
View Details
Recombinant Mouse IL-1RL2
Pr23140-04 1 mg

Recombinant Mouse IL-1RL2

Sign In for Pricing
View Details
Diphenhydramine-d6 Hydrochloride
010726-01 1 mg

Diphenhydramine-d6 Hydrochloride

Sign In for Pricing
View Details
Diphenhydramine-d6 Hydrochloride
010726-02 5 mg

Diphenhydramine-d6 Hydrochloride

Sign In for Pricing
View Details