Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE1 Peptide - C-terminal region

ADGRE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EMR1, TM7LN3

UniProt

Q14246

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE1 Rabbit Polyclonal Antibody (orb585959) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001965

Preservative

Lyophilized powder

AA Sequence

GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®647 Goat Anti-Guinea Pig IgG (H+L), 2 mg/mL
#20041 1x 500 µL

CF®647 Goat Anti-Guinea Pig IgG (H+L), 2 mg/mL

Sign In for Pricing
View Details
Recombinant Borrelia Afzelii gltX Protein (aa 1-490)
VAng-Lsx1688-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Afzelii gltX Protein (aa 1-490)

Sign In for Pricing
View Details
Sheep IL-8 ELISA Kit
orb568080-01 48 Tests

Sheep IL-8 ELISA Kit

Sign In for Pricing
View Details
Sheep IL-8 ELISA Kit
orb568080-02 96 Tests

Sheep IL-8 ELISA Kit

Sign In for Pricing
View Details
EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4) (MaxLight 750) discontinued
245770-ML750 100 µL

EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni gpsA Protein (aa 1-297) (strain RM1221)
VAng-Ly2660-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni gpsA Protein (aa 1-297) (strain RM1221)

Sign In for Pricing
View Details