Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE1 Peptide - C-terminal region

ADGRE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EMR1, TM7LN3

UniProt

Q14246

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE1 Rabbit Polyclonal Antibody (orb585959) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001965

Preservative

Lyophilized powder

AA Sequence

GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccr9 shRNA (UAS) - Lentiviral mouseCcr9 shRNA (UAS, GFP) (25)
GTR15197972 1 Vial

Lentiviral mouse Ccr9 shRNA (UAS) - Lentiviral mouseCcr9 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-OR6C1 antibody
STJ192759 200 µl

Anti-OR6C1 antibody

Sign In for Pricing
View Details
Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit
MBS7239603-01 48 Well

Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details
Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit
MBS7239603-02 96 Well

Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details
Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit
MBS7239603-03 5x 96 Well

Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details
Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit
MBS7239603-04 10x 96 Well

Goat CREB-regulated transcription coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details