Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USO1 Peptide - N-terminal region

USO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P115, TAP, VDP

UniProt

O60763

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USO1 Rabbit Polyclonal Antibody (orb331288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003706

Preservative

Lyophilized powder

AA Sequence

QTDRSDSEIIGYALDILYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-L-aspartic Acid-d3
TRC-A168608-1MG 1 mg

N-Acetyl-L-aspartic Acid-d3

Sign In for Pricing
View Details
1,5-Cyclooctadiene(pyridine)(tricyclohexylphosphine)iridium(I) Hexafluorophosphate
TRC-C984570-50MG 50 mg

1,5-Cyclooctadiene(pyridine)(tricyclohexylphosphine)iridium(I) Hexafluorophosphate

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF808094 100 µg

POTEG Mouse Monoclonal Antibody [Clone ID: OTI2B5]

Sign In for Pricing
View Details
Urelumab Biosimilar - Research Grade
ICH5015-5mg 5 mg

Urelumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Human OTOP3 activation kit by CRISPRa
GA117665 1 Kit

Human OTOP3 activation kit by CRISPRa

Sign In for Pricing
View Details
LIPF (NM_001198829) Human Over-expression Lysate
LY434213 100 µg

LIPF (NM_001198829) Human Over-expression Lysate

Sign In for Pricing
View Details