Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USO1 Peptide - N-terminal region

USO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P115, TAP, VDP

UniProt

O60763

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USO1 Rabbit Polyclonal Antibody (orb331288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003706

Preservative

Lyophilized powder

AA Sequence

QTDRSDSEIIGYALDILYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DKK1 Antibody Pair Set
E-KAB-0522 50 µL & 100 µg

Human DKK1 Antibody Pair Set

Sign In for Pricing
View Details
Jagged1 (JAG1) (C-term) Rabbit Polyclonal Antibody
AP52261PU-N 400 µL

Jagged1 (JAG1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGFR4 (NM_213647) Human Over-expression Lysate
LY431021 100 µg

FGFR4 (NM_213647) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Ethylbenzoic acid
TRC-E899815-2.5G 2.5 g

4-Ethylbenzoic acid

Sign In for Pricing
View Details
SPATA24 (NM_194296) Human Over-expression Lysate
LC430677 20 µg

SPATA24 (NM_194296) Human Over-expression Lysate

Sign In for Pricing
View Details
beta 1 Adrenergic Receptor (ADRB1) Human Gene Knockout Kit (CRISPR)
KN217134BN 1 Kit

beta 1 Adrenergic Receptor (ADRB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details