Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR35 Peptide - C-terminal region

GPR35 Peptide - C-terminal region

Product Specifications

UniProt

Q9HC97

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR35 Rabbit Polyclonal Antibody (orb586029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182310

Preservative

Lyophilized powder

AA Sequence

YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STYXL2 (NM_001080426) Human Over-expression Lysate
LC421643 20 µg

STYXL2 (NM_001080426) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant TUBB4A Antibody
RC-4264-01 50 μL

Recombinant TUBB4A Antibody

Sign In for Pricing
View Details
Recombinant TUBB4A Antibody
RC-4264-02 100 µL

Recombinant TUBB4A Antibody

Sign In for Pricing
View Details
Recombinant TUBB4A Antibody
RC-4264-03 1 mL

Recombinant TUBB4A Antibody

Sign In for Pricing
View Details
Recombinant ADK Monoclonal Antibody
AN301852L-01 50 µL

Recombinant ADK Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ADK Monoclonal Antibody
AN301852L-02 100 µL

Recombinant ADK Monoclonal Antibody

Sign In for Pricing
View Details