Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR35 Peptide - C-terminal region

GPR35 Peptide - C-terminal region

Product Specifications

UniProt

Q9HC97

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR35 Rabbit Polyclonal Antibody (orb586029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182310

Preservative

Lyophilized powder

AA Sequence

YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(+)-a-Lipoic Acid
TRC-L468725-5G 5 g

(R)-(+)-a-Lipoic Acid

Sign In for Pricing
View Details
2,4-Dinitro-1H-imidazole
TRC-D479900-500MG 500 mg

2,4-Dinitro-1H-imidazole

Sign In for Pricing
View Details
TAB1 Rabbit Polyclonal Antibody
HA500400 100 µL

TAB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DUSP6 Recombinant Rabbit monoclonal Antibody
HA750032 100 µL

DUSP6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cyba (NM_007806) Mouse Tagged ORF Clone
MG201856 10 µg

Cyba (NM_007806) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]
HA720175F 100 µL

iFluor™ 594 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]

Sign In for Pricing
View Details