Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIP2 Peptide - C-terminal region

GRIP2 Peptide - C-terminal region

Product Specifications

UniProt

Q9C0E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIP2 Rabbit Polyclonal Antibody (orb586032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073892

Preservative

Lyophilized powder

AA Sequence

IRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ergothioneine L- (+), Antioxidant, endogenous
TBI3012-25MG 25 mg

Ergothioneine L- (+), Antioxidant, endogenous

Sign In for Pricing
View Details
CCT8L2 siRNA (Human)
orb1852618-01 15 nmol

CCT8L2 siRNA (Human)

Sign In for Pricing
View Details
CCT8L2 siRNA (Human)
orb1852618-02 30 nmol

CCT8L2 siRNA (Human)

Sign In for Pricing
View Details
SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE) (PE)
138335-PE 100 µL

SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE) (PE)

Sign In for Pricing
View Details
Gbp4 Rabbit Polyclonal Antibody (Fluoro550)
orb3095657 100 µg

Gbp4 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
ALG12 (Biotin)
554906-01 50 µg

ALG12 (Biotin)

Sign In for Pricing
View Details