Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIP2 Peptide - C-terminal region

GRIP2 Peptide - C-terminal region

Product Specifications

UniProt

Q9C0E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIP2 Rabbit Polyclonal Antibody (orb586032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073892

Preservative

Lyophilized powder

AA Sequence

IRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mueller Kauffman Tetrathionate HiVeg® Broth Base
MV876-500G 500 g

Mueller Kauffman Tetrathionate HiVeg® Broth Base

Sign In for Pricing
View Details
D-Aspartic acid b tert-butyl ester
260588-01 500 mg

D-Aspartic acid b tert-butyl ester

Sign In for Pricing
View Details
D-Aspartic acid b tert-butyl ester
260588-02 1 g

D-Aspartic acid b tert-butyl ester

Sign In for Pricing
View Details
D-Aspartic acid b tert-butyl ester
260588-03 2 g

D-Aspartic acid b tert-butyl ester

Sign In for Pricing
View Details
D-Aspartic acid b tert-butyl ester
260588-04 5 g

D-Aspartic acid b tert-butyl ester

Sign In for Pricing
View Details
D-Aspartic acid b tert-butyl ester
260588-05 10 g

D-Aspartic acid b tert-butyl ester

Sign In for Pricing
View Details