Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR12 Peptide - C-terminal region

GPR12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ18149, FLJ97704, GPCR12, GPCR21, MGC138349, MGC138351

UniProt

P47775

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR12 Rabbit Polyclonal Antibody (orb586042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005279

Preservative

Lyophilized powder

AA Sequence

SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 6 Antibody (rKRT6/9402) [Alexa Fluor 700]
NBP3-24257AF700 0.1 mL

Mouse Monoclonal Cytokeratin 6 Antibody (rKRT6/9402) [Alexa Fluor 700]

Sign In for Pricing
View Details
FLRT3 (NM_198391) Human Tagged ORF Clone Lentiviral Particle
RC205052L2V 200 µL

FLRT3 (NM_198391) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Phospho-NUDC (Ser326) Polyclonal Antibody
TMAC-02899-01 50 μL

Anti-Phospho-NUDC (Ser326) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-NUDC (Ser326) Polyclonal Antibody
TMAC-02899-02 100 µL

Anti-Phospho-NUDC (Ser326) Polyclonal Antibody

Sign In for Pricing
View Details
PIGR Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2403855 100 µL

PIGR Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Cy3.5 tetrazine
orb3133385-01 50 mg

Cy3.5 tetrazine

Sign In for Pricing
View Details