Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR12 Peptide - C-terminal region

GPR12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ18149, FLJ97704, GPCR12, GPCR21, MGC138349, MGC138351

UniProt

P47775

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR12 Rabbit Polyclonal Antibody (orb586042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005279

Preservative

Lyophilized powder

AA Sequence

SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)
MBS2098171-01 5x 96 Tests

Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)
MBS2098171-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)
MBS2098171-03 10x 96 Tests

Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)
MBS2098171-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Angiotensin I Converting Enzyme (ACE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat C1qa/Complement C1q subcomponent subunit A ELISA Kit
EK19368 Inquire

Rat C1qa/Complement C1q subcomponent subunit A ELISA Kit

Sign In for Pricing
View Details
GPHB5 Protein Vector (Rat) (pPB-C-His)
PV270978 500 ng

GPHB5 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details