Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABLES1 Peptide - C-terminal region

CABLES1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CABLES, FLJ35924, HsT2563, IK3-1, CABL1

UniProt

Q8TDN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABLES1 Rabbit Polyclonal Antibody (orb586067) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094089

Preservative

Lyophilized powder

AA Sequence

IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAPTA AM - calcium chelator
1081T 25 mg

BAPTA AM - calcium chelator

Sign In for Pricing
View Details
Recombinant Human NEIL1 Protein (His Tag)
PKSH030794 50 µg

Recombinant Human NEIL1 Protein (His Tag)

Sign In for Pricing
View Details
Nuclear Membrane (NM97), CF405S conjugate, 0.1mg/mL
BNC040097-100 1x 100 µL

Nuclear Membrane (NM97), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Bromonapthalene
TRC-B685900-25G 25 g

1-Bromonapthalene

Sign In for Pricing
View Details
Torin 1
TRC-T548700-25MG 25 mg

Torin 1

Sign In for Pricing
View Details
CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF405S conjugate, 0.1mg/mL
BNC042751-100 1x 100 µL

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details