Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABLES1 Peptide - C-terminal region

CABLES1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CABLES, FLJ35924, HsT2563, IK3-1, CABL1

UniProt

Q8TDN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABLES1 Rabbit Polyclonal Antibody (orb586067) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094089

Preservative

Lyophilized powder

AA Sequence

IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DTX2 activation kit by CRISPRa
GA114423 1 Kit

Human DTX2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561701 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Human SMIM40 activation kit by CRISPRa
GA120092 1 Kit

Human SMIM40 activation kit by CRISPRa

Sign In for Pricing
View Details
CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF805781 100 µg

CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details
TGFalpha (TG86), Biotin conjugate, 0.1mg/mL
BNCB0786-100 1x 100 µL

TGFalpha (TG86), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EBLN2 Mouse Monoclonal Antibody [Clone ID: OTI3E1]
CF808875 100 µg

EBLN2 Mouse Monoclonal Antibody [Clone ID: OTI3E1]

Sign In for Pricing
View Details