Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EAF2 Peptide - C-terminal region

EAF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BM040, TRAITS, U19

UniProt

Q96CJ1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EAF2 Rabbit Polyclonal Antibody (orb586069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060926

Preservative

Lyophilized powder

AA Sequence

SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasip1 Rat siRNA Oligo Duplex (Locus ID 292912)
SR511052 1 Kit

Rasip1 Rat siRNA Oligo Duplex (Locus ID 292912)

Sign In for Pricing
View Details
Chicken Ubiquitin thioesterase OTU1, YOD1 ELISA KIT
ELI-44529c 96 Tests

Chicken Ubiquitin thioesterase OTU1, YOD1 ELISA KIT

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. phaseolicola Glucans biosynthesis glucosyltransferase H (opgH), partial
MBS7080307 Inquire

Recombinant Pseudomonas syringae pv. phaseolicola Glucans biosynthesis glucosyltransferase H (opgH), partial

Sign In for Pricing
View Details
Thiomorpholine-1-oxide hydrochloride
BDA17687-01 2.5 g

Thiomorpholine-1-oxide hydrochloride

Sign In for Pricing
View Details
Thiomorpholine-1-oxide hydrochloride
BDA17687-02 25 g

Thiomorpholine-1-oxide hydrochloride

Sign In for Pricing
View Details
Recombinant Human Bcl-2-like protein 2
MBS1433948-01 0.02 mg (E-Coli)

Recombinant Human Bcl-2-like protein 2

Sign In for Pricing
View Details