Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EAF2 Peptide - C-terminal region

EAF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BM040, TRAITS, U19

UniProt

Q96CJ1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EAF2 Rabbit Polyclonal Antibody (orb586069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060926

Preservative

Lyophilized powder

AA Sequence

SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-c-Fms antibody
STJ92243 200 µl

Anti-c-Fms antibody

Sign In for Pricing
View Details
PIN1 Antibody (Center)
orb1427630-01 50 µL

PIN1 Antibody (Center)

Sign In for Pricing
View Details
PIN1 Antibody (Center)
orb1427630-02 100 µL

PIN1 Antibody (Center)

Sign In for Pricing
View Details
M-Toluic hydrazide
sc-269349 5 g

M-Toluic hydrazide

Sign In for Pricing
View Details
DBPA (YBX3) Rabbit Polyclonal Antibody
TA330132 100 µL

DBPA (YBX3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EG668106 siRNA (m)
sc-144501 10 µM

EG668106 siRNA (m)

Sign In for Pricing
View Details