Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELPLG Peptide - C-terminal region

SELPLG Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD162, CLA, PSGL-1, PSGL1

UniProt

Q14242

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SELPLG Rabbit Polyclonal Antibody (orb586297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002997

Preservative

Lyophilized powder

AA Sequence

EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF Receptor beta (PDGFRB) Rabbit Polyclonal Antibody
AP20360PU-N 100 µg

PDGF Receptor beta (PDGFRB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRA Mouse Monoclonal Antibody [Clone ID: IPO-10]
AM32359PU-T 20 µg

HLA-DRA Mouse Monoclonal Antibody [Clone ID: IPO-10]

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/3156R), CF568 conjugate, 0.1mg/mL
BNC683156-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CTRL Protein (His Tag)
PKSH032253-01 10 µg

Recombinant Human CTRL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CTRL Protein (His Tag)
PKSH032253-02 50 µg

Recombinant Human CTRL Protein (His Tag)

Sign In for Pricing
View Details
Human 14-3-3 beta (YWHAB) activation kit by CRISPRa
GA105181 1 Kit

Human 14-3-3 beta (YWHAB) activation kit by CRISPRa

Sign In for Pricing
View Details