Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELPLG Peptide - C-terminal region

SELPLG Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD162, CLA, PSGL-1, PSGL1

UniProt

Q14242

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SELPLG Rabbit Polyclonal Antibody (orb586297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002997

Preservative

Lyophilized powder

AA Sequence

EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Sealing Mats for DW Plates
D3320-41S 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), Biotin conjugate, 0.1mg/mL
BNCB2123-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADAMTS8 Rabbit Polyclonal Antibody
TA371757 100 µL

ADAMTS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human HCLS1 Protein (His Tag)
PKSH032527-01 10 µg

Recombinant Human HCLS1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HCLS1 Protein (His Tag)
PKSH032527-02 50 µg

Recombinant Human HCLS1 Protein (His Tag)

Sign In for Pricing
View Details
AKT3 Mouse Monoclonal Antibody [Clone ID: 9A5.H9.G7]
TA396818S 25 µL

AKT3 Mouse Monoclonal Antibody [Clone ID: 9A5.H9.G7]

Sign In for Pricing
View Details