Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELPLG Peptide - N-terminal region

SELPLG Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD162, CLA, PSGL-1, PSGL1

UniProt

Q14242

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SELPLG Rabbit Polyclonal Antibody (orb586298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002997

Preservative

Lyophilized powder

AA Sequence

GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Annexin A10 (ANXA10) ELISA kit
GTR10406201 96 Well

Sheep Annexin A10 (ANXA10) ELISA kit

Sign In for Pricing
View Details
ZNF587 (Zinc Finger Protein 587, ZF6) (FITC)
135774-FITC 100 µL

ZNF587 (Zinc Finger Protein 587, ZF6) (FITC)

Sign In for Pricing
View Details
SPY1 Rabbit Polyclonal Antibody
JOT-AP04876-01 20 µL

SPY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPY1 Rabbit Polyclonal Antibody
JOT-AP04876-02 50 μL

SPY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPY1 Rabbit Polyclonal Antibody
JOT-AP04876-03 100 µL

SPY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Rbm34 Pre-designed siRNA Set A
SI111771A 1 Each

Mouse Rbm34 Pre-designed siRNA Set A

Sign In for Pricing
View Details